DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and try-1

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:289 Identity:97/289 - (33%)
Similarity:135/289 - (46%) Gaps:42/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   589 NYGPVNNEPSCG-----ISLAKQ----------TAQRRIVGGDDAGFGSFPW--QAYIRIGSSRC 636
            |...|..:..||     :.||:.          |...|::||.::...|:||  |...|:|..||
 Worm    20 NKNDVIEKVGCGLHSTNVELAQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRC 84

  Fly   637 GGSLISRRHVVTAGHCVAR-ATPRQVHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKF-TPQA 699
            |||||....|:||.||.|: ..|....|.:|.:...|. .|     ..|..:.:||::.. .|.:
 Worm    85 GGSLIDPNFVLTAAHCFAKDRRPTSYSVRVGGHRSGSG-SP-----HRVTAVSIHPWYNIGFPSS 143

  Fly   700 DRFDISVLTLERTVHFMPHIAPICLPE----KNEDFLGKFGWAAGWGALNPGSRLRPKTLQAVDV 760
              :|.:::.:...|:......|||||.    :|     :.....|||:...||.|...||:.:.|
 Worm   144 --YDFAIMRIHPPVNTSTTARPICLPSLPAVEN-----RLCVVTGWGSTIEGSSLSAPTLREIHV 201

  Fly   761 PVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYS 825
            |::....|.  ...|.|..:....||||||..|..||||||||||||..::|.|.|.||||.|..
 Worm   202 PLLSTLFCS--SLPNYIGRIHLPSMLCAGYSYGKIDSCQGDSGGPLMCARDGHWELTGVVSWGIG 264

  Fly   826 CASRGQPGIYHSVSKTVDWVSYVVGLTMN 854
            ||..|.||:|.:|.....|::    |.||
 Worm   265 CARPGMPGVYGNVHSASTWIN----LEMN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/241 (36%)
Tryp_SPc 612..846 CDD:238113 86/241 (36%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 86/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.