DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Prss50

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_017451624.2 Gene:Prss50 / 100910205 RGDID:6499372 Length:424 Species:Rattus norvegicus


Alignment Length:303 Identity:79/303 - (26%)
Similarity:121/303 - (39%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   583 TDLPQKNYGPVN--------------NEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI-G 632
            |..|.|..|.::              |.|.||.|.......|    ..:|....:||...::. |
  Rat   113 TTTPPKGMGALSTVGITGSVSKTKPGNLPLCGSSQEPDPTLR----DPEAMTRRWPWMVSVQTNG 173

  Fly   633 SSRCGGSLISRRHVVTAGHCVA----------------RATPRQVHVTLGDYVINSAVEPLPAYT 681
            |..|.|.||:.:.|:...||::                :.|.....|.:...:|||..:. ..|.
  Rat   174 SHVCAGILIASQWVLAVAHCLSQNRVNYTVRVGSPWINQTTETSSDVPVNQVIINSGYQS-KRYW 237

  Fly   682 FGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKN---EDFLGKFGWAAGWGA 743
            ..|.||              .||.:|.|:..:.:..::.|:|||...   ||  |......||| 
  Rat   238 SWVGRI--------------HDIGLLKLKWGLKYSKYVWPVCLPGLEYVVED--GSLCTVTGWG- 285

  Fly   744 LNPGSRLRP--KTLQAVDVPVIENRICERWH----RQNGINVVIYQEMLCAGYRNGGKDSCQGDS 802
            ....:.|.|  :|||..:|.::.:|.||.::    |.:.:..:|..:|:|| ..|..:..|...|
  Rat   286 YPKANGLWPQFQTLQEKEVSILNSRECEHYYHKFSRIHSLVRIISPQMICA-LDNDREKFCYERS 349

  Fly   803 GGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            |.||:...:|.|||:||:|.|..|.....|.|:..||....|:
  Rat   350 GEPLVCSSDGMWYLVGVMSWGPGCKKSEAPPIFLQVSHYQLWI 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 68/259 (26%)
Tryp_SPc 612..846 CDD:238113 69/260 (27%)
Prss50XP_017451624.2 Tryp_SPc 162..392 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.