DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and zgc:165423

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005164170.1 Gene:zgc:165423 / 100101646 ZFINID:ZDB-GENE-070720-11 Length:538 Species:Danio rerio


Alignment Length:262 Identity:98/262 - (37%)
Similarity:135/262 - (51%) Gaps:16/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   592 PVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCV-A 654
            |..:.|:||    |.....:||||.:|..||:||||.: ..||..|||||||.:.:::|.||. :
Zfish    22 PTQSPPACG----KAPLNTKIVGGTNASAGSWPWQASLHESGSHFCGGSLISDQWILSAAHCFPS 82

  Fly   655 RATPRQVHVTLGDYVINSAVEPLP-AYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPH 718
            ...|....|.||.   .|...|.| ..:..|.::.|||.::.:...:  |:::|.|...|.|..:
Zfish    83 NPNPSDYTVYLGR---QSQDLPNPNEVSKSVSQVIVHPLYQGSTHDN--DMALLHLSSPVTFSNY 142

  Fly   719 IAPICLPEKNEDFLGKFGWAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNGINVVIY 782
            |.|:||......|.....|..|||.:..|..| .|:.||.|:||::.|.:|...:   |....|.
Zfish   143 IQPVCLAADGSTFYNDTMWITGWGTIESGVSLPSPQILQEVNVPIVGNNLCNCLY---GGGSSIT 204

  Fly   783 QEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSY 847
            ..|:|||...|||||||||||||::......|...||||.|..||....||:|..||:..:|:|.
Zfish   205 NNMMCAGLMQGGKDSCQGDSGGPMVIKSFNTWVQAGVVSFGKGCADPNYPGVYARVSQYQNWISQ 269

  Fly   848 VV 849
            .|
Zfish   270 YV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 90/237 (38%)
Tryp_SPc 612..846 CDD:238113 91/237 (38%)
zgc:165423XP_005164170.1 Tryp_SPc 37..267 CDD:214473 90/237 (38%)
Tryp_SPc 38..269 CDD:238113 91/238 (38%)
Tryp_SPc 299..473 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.