DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:301 Identity:93/301 - (30%)
Similarity:138/301 - (45%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQF 150
            :||:.:.:|.|....                  |.|:|   |||.........::||:||..|:.
Human   152 NPSTEITSLTDQAAA------------------NWLIN---ECGAGPDLITLSEQRILGGTEAEE 195

  Fly   151 AEYPWQAHIRIAE-YQCGGVLISANMVATAAHCIQ-QAHLADITVYLGELDTQDLGHIHEPLPVE 213
            ..:|||..:|:.. :.|||.||:...:.|||||.: .::..|.....|         |....|..
Human   196 GSWPWQVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPRDWIATSG---------ISTTFPKL 251

  Fly   214 KHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRL-IGRKGLIAGWGK 277
            :..|...:||.  |::....:. ||||::|....:||:.|..:|||.....: .|....:.|||.
Human   252 RMRVRNILIHN--NYKSATHEN-DIALVRLENSVTFTKDIHSVCLPAATQNIPPGSTAYVTGWGA 313

  Fly   278 TEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLV 342
            .| :.||....:.| ..|.||:...|...|   ..|..|.:.|.|||...|.:|||.||||||||
Human   314 QE-YAGHTVPELRQ-GQVRIISNDVCNAPH---SYNGAILSGMLCAGVPQGGVDACQGDSGGPLV 373

  Fly   343 IKERGR-FVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQE 382
            .::..| :.:|||.|.|..||:..:||:|..|...:.||::
Human   374 QEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 81/242 (33%)
Tryp_SPc 142..383 CDD:238113 82/245 (33%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699
Tryp_SPc 186..412 CDD:214473 81/242 (33%)
Tryp_SPc 187..415 CDD:238113 82/245 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.