DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and prss60.1

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:268 Identity:86/268 - (32%)
Similarity:128/268 - (47%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRIAEYQ---CGGVLISANMVATAAHCIQQAHLA 189
            ||:.     .|..||:||..|....:|||..:....|.   |||.||::..|.|||||:.:...:
Zfish    25 CGLA-----PLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTS 84

  Fly   190 DITVYLGELDTQDLG--HIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEH 252
            .:.|:||:...|.:.  .|:..:.|       ..:||.:| .:|..:  |||||.|:...:|:.:
Zfish    85 SLLVFLGKTTQQGVNTYEINRTVSV-------ITVHPSYN-NLTNEN--DIALLHLSSAVTFSNY 139

  Fly   253 ILPICL-PQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEI 316
            |.|:|| .|..:...|....|.|||..:..:......:||...:|::....|.....|..:.   
Zfish   140 IRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVT--- 201

  Fly   317 KAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQ 381
             ..|.|||...|..|.|.||||||:|.|:...:|..||||.|:||...:.||:|..|.:...||.
Zfish   202 -NNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWIN 265

  Fly   382 EVVARNEP 389
            .::.:|.|
Zfish   266 SIIVQNLP 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 79/244 (32%)
Tryp_SPc 142..383 CDD:238113 80/246 (33%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 79/244 (32%)
Tryp_SPc 34..267 CDD:238113 80/246 (33%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.