DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Prss8

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:286 Identity:94/286 - (32%)
Similarity:127/286 - (44%) Gaps:35/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 RRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVAT 178
            |.|..|     ..||.      .:|.||.||..|:..::|||..|.. ..:.|||.|:|...|.:
Mouse    29 RADGTE-----ASCGA------VIQPRITGGGSAKPGQWPWQVSITYDGNHVCGGSLVSNKWVVS 82

  Fly   179 AAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKL 243
            ||||..:.|..:  .|..:|....|........|  |.|.|.|.|..:....:|.   ||||::|
Mouse    83 AAHCFPREHSRE--AYEVKLGAHQLDSYSNDTVV--HTVAQIITHSSYREEGSQG---DIALIRL 140

  Fly   244 AQPTSFTEHILPICLP----QYPIRLIGRKGL---IAGWGKTEAHMGHAGTNMLQVASVPIITTL 301
            :.|.:|:.:|.|||||    .:|      .||   :.|||.....:.......||...||:|:..
Mouse   141 SSPVTFSRYIRPICLPAANASFP------NGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRE 199

  Fly   302 DCIRWHESKQINVE---IKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGV 363
            .|...:....:..|   |:.:|.|||:..|..|||.|||||||.....|.:.|.||.|.|..||.
Mouse   200 TCSCLYNINAVPEEPHTIQQDMLCAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSWGDACGA 264

  Fly   364 DHQPGIYHNVQKTVRWIQEVVARNEP 389
            .::||:|........||...||..:|
Mouse   265 PNRPGVYTLTSTYASWIHHHVAELQP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 83/249 (33%)
Tryp_SPc 142..383 CDD:238113 84/251 (33%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 84/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.