DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and TMPRSS2

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001128571.1 Gene:TMPRSS2 / 7113 HGNCID:11876 Length:529 Species:Homo sapiens


Alignment Length:441 Identity:123/441 - (27%)
Similarity:186/441 - (42%) Gaps:107/441 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ICQSSPSQANILNTLLG----------------VPAECVHQSGVWPCKLSFSC-----WLQGGKH 58
            :|.|...:|..:...||                :.::| ..||: .|..|.:|     |..|..|
Human   113 VCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKC-SNSGI-ECDSSGTCINPSNWCDGVSH 175

  Fly    59 AKG------C----GSNKWLFSCCVAETQ----HPHQQQHHSPSSPLANLVDYGK---------- 99
            ..|      |    |.|   |...|..:|    ||..|...:.:...|...|.|.          
Human   176 CPGGEDENRCVRLYGPN---FILQVYSSQRKSWHPVCQDDWNENYGRAACRDMGYKNNFYSSQGI 237

  Fly   100 ---------LKLNLNS----LPKRIMLRRRDDNELLNPKP-------ECGVPRTAQNTLQKRIIG 144
                     :|||.::    :.|::.     .::..:.|.       .|||  ...::.|.||:|
Human   238 VDDSGSTSFMKLNTSAGNVDIYKKLY-----HSDACSSKAVVSLRCIACGV--NLNSSRQSRIVG 295

  Fly   145 GRPAQFAEYPWQAHIRIAE-YQCGGVLISANMVATAAHCIQQA-----HLADITVYLGELDTQDL 203
            |..|....:|||..:.:.. :.|||.:|:...:.|||||:::.     |.   |.:.|.| .|..
Human   296 GESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHW---TAFAGIL-RQSF 356

  Fly   204 GHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGR 268
            ........|||     .|.||.::   ::....||||:||.:|.:|.:.:.|:|||. |..::..
Human   357 MFYGAGYQVEK-----VISHPNYD---SKTKNNDIALMKLQKPLTFNDLVKPVCLPN-PGMMLQP 412

  Fly   269 KGL--IAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQI--NVEIKAEMFCAGHSDGH 329
            :.|  |:|||.|| ..|.. :.:|..|.|.:|.|..|    .|:.:  |: |...|.|||...|:
Human   413 EQLCWISGWGATE-EKGKT-SEVLNAAKVLLIETQRC----NSRYVYDNL-ITPAMICAGFLQGN 470

  Fly   330 MDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380
            :|:|.||||||||..:...:.|:|.||.|.||...::||:|.||.....||
Human   471 VDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWI 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/248 (34%)
Tryp_SPc 142..383 CDD:238113 86/249 (35%)
TMPRSS2NP_001128571.1 DUF3824 <44..91 CDD:289625
LDLa 150..185 CDD:238060 10/36 (28%)
SRCR_2 190..283 CDD:292133 17/100 (17%)
Tryp_SPc 292..521 CDD:214473 85/248 (34%)
Tryp_SPc 293..524 CDD:238113 86/249 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.