DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss11d

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001028824.2 Gene:Tmprss11d / 64565 RGDID:620654 Length:417 Species:Rattus norvegicus


Alignment Length:301 Identity:93/301 - (30%)
Similarity:145/301 - (48%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQF 150
            :||:.:.:|.|                   :|...:|.  .|||.........::|||||..|:.
  Rat   151 APSNEITSLTD-------------------QDTENVLT--QECGARPDLITLSEERIIGGTQAET 194

  Fly   151 AEYPWQAHIRIAE-YQCGGVLISANMVATAAHCIQQ-AHLADITVYLGELDTQDLGHIHEPLPVE 213
            .::|||..:::.. :.|||.|||...|.|||||.:. ::....|...|      :..|...|.|.
  Rat   195 GDWPWQVSLQLNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFG------VSTISPRLRVR 253

  Fly   214 KHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLI-GRKGLIAGWGK 277
            ...:|   .|..:| .:|:.:  |||:::|.:|.:||.:|..:|||.....:| .....:.|||.
  Rat   254 VRAIL---AHAEYN-SITRDN--DIAVVQLDRPVTFTRNIHRVCLPAATQNIIPDSVAYVTGWGS 312

  Fly   278 TEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLV 342
            . .:.|:..|| ||...|.|:::..|   :|.......:...|.|||...|.:|||.||||||||
  Rat   313 L-TYGGNTVTN-LQQGEVRIVSSEVC---NEPAGYGGSVLPGMLCAGVRSGAVDACQGDSGGPLV 372

  Fly   343 IKERGR-FVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQE 382
            .::..| :.:|||.|.|:.||:.::||:|..|.....||::
  Rat   373 QEDTRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQ 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 82/242 (34%)
Tryp_SPc 142..383 CDD:238113 83/245 (34%)
Tmprss11dNP_001028824.2 SEA 48..150 CDD:396113
Tryp_SPc 186..414 CDD:238113 83/245 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.