DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and zgc:123217

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001032480.1 Gene:zgc:123217 / 641414 ZFINID:ZDB-GENE-051113-188 Length:326 Species:Danio rerio


Alignment Length:288 Identity:102/288 - (35%)
Similarity:133/288 - (46%) Gaps:22/288 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 GKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI- 161
            |.|.|.|:|..  |||..:|.|  .....||||.     .|..||:||..|....:|||..|.. 
Zfish     2 GLLVLLLSSAV--IMLSTQDSN--AQTTYECGVA-----PLNTRIVGGTDAPAGSWPWQVSIHYN 57

  Fly   162 AEYQCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRF 226
            ..:.|||.||.:..|.||||||...::...|:|||. .||... :..|..| |.|:...|.||.|
Zfish    58 NRHICGGTLIHSQWVMTAAHCIINTNINVWTLYLGR-QTQSTS-VANPNEV-KVGIQSIIDHPSF 119

  Fly   227 NFRMTQPDRYDIALLKLAQPTSFTEHILPICL-PQYPIRLIGRKGLIAGWGKTEAHMGHAGTNML 290
            |..:.   ..||:|:||:||.:|:.:|.|||| ....|...|......|||.............|
Zfish   120 NNSLL---NNDISLMKLSQPVNFSLYIRPICLAANNSIFYNGTSCWATGWGNIGKDQALPAPQTL 181

  Fly   291 QVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGIT 355
            |...:|::....|...:||.. |..|..:|.|||.:  :...|.||||||...|:...::..|||
Zfish   182 QQVQIPVVANSLCSTEYESVN-NATITPQMICAGKA--NKGTCQGDSGGPFQCKQGSVWIQAGIT 243

  Fly   356 SAG--FGCGVDHQPGIYHNVQKTVRWIQ 381
            |.|  .||.|...|.:|..|.:...||:
Zfish   244 SYGTSAGCAVGAYPDVYSRVSEFQSWIK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/242 (35%)
Tryp_SPc 142..383 CDD:238113 86/244 (35%)
zgc:123217NP_001032480.1 Tryp_SPc 36..270 CDD:214473 85/242 (35%)
Tryp_SPc 37..273 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450300at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.