DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and PRSS22

DIOPT Version :10

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_054169579.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:425 Species:Homo sapiens


Alignment Length:78 Identity:19/78 - (24%)
Similarity:31/78 - (39%) Gaps:22/78 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KKYRHPALDRQLTRQRI--KAEQKAFQR-----CAA------AGLSTPALYGVDLE--------- 83
            ::.|...|.:....|||  ..||:.|:|     |||      .|..:..|..:..:         
Human   146 QRQRLKTLCKDCRAQRIAFNREQRMFKRVGCGECAACQVTEDCGACSTCLLQLPHDVASGLFCKC 210

  Fly    84 QRKIYMEYLERSR 96
            :|:..:..:||||
Human   211 ERRRCLRIVERSR 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 142..383 CDD:238113
PRSS22XP_054169579.1 Tryp_SPc 158..396 CDD:238113 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.