DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:341 Identity:104/341 - (30%)
Similarity:155/341 - (45%) Gaps:49/341 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SNKWLFSCC-------VAETQHPHQQQHHSPSSPLANLVDYGK------LKLNLNSLPKRIMLRR 115
            :..| ||.|       :|||  ..:|..:| |.|....|:.|.      :::..||...|:   |
Human   120 TGNW-FSACFDNFTEALAET--ACRQMGYS-SKPTFRAVEIGPDQDLDVVEITENSQELRM---R 177

  Fly   116 RDDNELLNPK------PECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISA 173
            ......|:..      ..||     ::....|::|...|....:|||..|:. .::.|||.::..
Human   178 NSSGPCLSGSLVSLHCLACG-----KSLKTPRVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDP 237

  Fly   174 NMVATAAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDI 238
            :.|.|||||.:: | .|:..:.....:..||.. ..|.|.|..:::        |....|...||
Human   238 HWVLTAAHCFRK-H-TDVFNWKVRAGSDKLGSF-PSLAVAKIIIIE--------FNPMYPKDNDI 291

  Fly   239 ALLKLAQPTSFTEHILPICLPQYPIRLIGRKGL-IAGWGKTEAHMGHAGTNMLQVASVPIITTLD 302
            ||:||..|.:|:..:.|||||.:...|.....| |.|||.|:.:.|.....:|| |||.:|   |
Human   292 ALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQ-ASVQVI---D 352

  Fly   303 CIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQP 367
            ..|.:.......|:..:|.|||..:|.:|.|.|||||||:. :..::.:|||.|.|:|||....|
Human   353 STRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMY-QSDQWHVVGIVSWGYGCGGPSTP 416

  Fly   368 GIYHNVQKTVRWIQEV 383
            |:|..|...:.||..|
Human   417 GVYTKVSAYLNWIYNV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 81/240 (34%)
Tryp_SPc 142..383 CDD:238113 82/242 (34%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 18/83 (22%)
Tryp_SPc 204..429 CDD:214473 81/240 (34%)
Tryp_SPc 205..432 CDD:238113 82/242 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.