DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and PRSS8

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:281 Identity:95/281 - (33%)
Similarity:129/281 - (45%) Gaps:46/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHLADI 191
            |||      ..|.||.||..|...::|||..|.. ..:.|||.|:|...|.:||||....|..: 
Human    37 CGV------APQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKE- 94

  Fly   192 TVYLGELDTQDLGHIHEPLPVEKHGVLQKII-HPRFNFRMTQPDRYDIALLKLAQPTSFTEHILP 255
             .|..:|....|....|...|   ..|:.|| ||.:   :.:..:.|||||:|::|.:|:.:|.|
Human    95 -AYEVKLGAHQLDSYSEDAKV---STLKDIIPHPSY---LQEGSQGDIALLQLSRPITFSRYIRP 152

  Fly   256 ICLP----QYPIRLIGRKGL---IAGWGKTEAHMGHAGTNMLQVASVPIIT--TLDCIRWHESKQ 311
            ||||    .:|      .||   :.|||.....:.......||...||:|:  |.:|:       
Human   153 ICLPAANASFP------NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCL------- 204

  Fly   312 INVEIKAE--------MFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPG 368
            .|::.|.|        |.|||:.:|..|||.|||||||.....|.:.|.||.|.|..||..::||
Human   205 YNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPG 269

  Fly   369 IYHNVQKTVRWIQEVVARNEP 389
            :|........|||..|...:|
Human   270 VYTLASSYASWIQSKVTELQP 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 86/257 (33%)
Tryp_SPc 142..383 CDD:238113 88/259 (34%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 86/257 (33%)
Tryp_SPc 45..284 CDD:238113 88/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.