DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and PLG

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_000292.1 Gene:PLG / 5340 HGNCID:9071 Length:810 Species:Homo sapiens


Alignment Length:357 Identity:111/357 - (31%)
Similarity:170/357 - (47%) Gaps:47/357 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CWLQGGKHAKGCGSNKWLFSCCVA-ETQHPHQQQHHSP-SSPLANLVDYGKLKLNLNSLP----- 108
            |....||..:|..:.....:.|.. ..|.||:....:| ::|.|.      |:.|....|     
Human   481 CMFGNGKGYRGKRATTVTGTPCQDWAAQEPHRHSIFTPETNPRAG------LEKNYCRNPDGDVG 539

  Fly   109 --------KRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHI--RIAE 163
                    .|.:....|..:...|..:||.|:........|::||..|....:|||..:  |...
Human   540 GPWCYTTNPRKLYDYCDVPQCAAPSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGM 604

  Fly   164 YQCGGVLISANMVATAAHCIQQA-HLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFN 227
            :.|||.|||...|.|||||:::: ..:...|.||         .|:.:.:|.|  :|:|...|. 
Human   605 HFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILG---------AHQEVNLEPH--VQEIEVSRL- 657

  Fly   228 FRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGRKG--LIAGWGKTEAHMGHAGTNML 290
              ..:|.|.|||||||:.|...|:.::|.|||. |..::..:.  .|.|||:|:   |..|..:|
Human   658 --FLEPTRKDIALLKLSSPAVITDKVIPACLPS-PNYVVADRTECFITGWGETQ---GTFGAGLL 716

  Fly   291 QVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGIT 355
            :.|.:|:|....|.|:   :.:|..:::...||||..|..|:|.||||||||..|:.:::|.|:|
Human   717 KEAQLPVIENKVCNRY---EFLNGRVQSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVT 778

  Fly   356 SAGFGCGVDHQPGIYHNVQKTVRWIQEVVARN 387
            |.|.||...::||:|..|.:.|.||:.|:..|
Human   779 SWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 87/243 (36%)
Tryp_SPc 142..383 CDD:238113 88/245 (36%)
PLGNP_000292.1 PAN_AP_HGF <38..97 CDD:238532
KR 101..183 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..145
KR 183..263 CDD:214527
KR 273..354 CDD:214527
KR 375..456 CDD:214527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 396..416
KR 479..560 CDD:214527 16/84 (19%)
Tryp_SPc 580..803 CDD:214473 87/243 (36%)
Tryp_SPc 581..804 CDD:238113 87/243 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto88341
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.