DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and prss36

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001005710.1 Gene:prss36 / 448231 XenbaseID:XB-GENE-5892976 Length:719 Species:Xenopus tropicalis


Alignment Length:265 Identity:87/265 - (32%)
Similarity:131/265 - (49%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHL- 188
            |.||.|     .:..||:||..|:...:|||..:|. ..:.|||.:|....:.|||||...:.. 
 Frog    26 PSCGSP-----LVSSRIVGGTDAREGAWPWQVSLRYRGSHICGGSVIGTQWILTAAHCFGNSQSP 85

  Fly   189 ADITVYLGELDTQDLGHIHEPLPVEKHGVLQKII-HPRFNFRMTQPDRY--DIALLKLAQPTSFT 250
            :|..|.||..      .:.|..|.|....:.:|| ||::: .:|    |  ||||::|..|..:|
 Frog    86 SDYEVRLGAY------RLAETSPNEITAKVDRIIMHPQYD-ELT----YFGDIALIRLTSPIDYT 139

  Fly   251 EHILPICLPQYPIRLI-GRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIR-WHESKQIN 313
            .:|||:|||....... |.:..:.|||||..::.......||....|:|....|.: :|....::
 Frog   140 AYILPVCLPSASNSFTDGMECWVTGWGKTAFNVNLPFPGTLQEVMTPLINRTRCDQMYHIDSPVS 204

  Fly   314 VE---IKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQK 375
            ..   |.::..|:|:|||..|:|.|||||.||.|.:..:..:||.|.|.||.:.::||:|..|..
 Frog   205 ASSEIIPSDQICSGYSDGGKDSCKGDSGGALVCKIQRVWYQIGIVSWGDGCAIANRPGVYTLVPA 269

  Fly   376 TVRWI 380
            ...|:
 Frog   270 YQSWL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 82/248 (33%)
Tryp_SPc 142..383 CDD:238113 82/249 (33%)
prss36NP_001005710.1 Tryp_SPc 37..276 CDD:238113 82/249 (33%)
Tryp_SPc 385..622 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.