DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss9

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006513905.2 Gene:Tmprss9 / 432478 MGIID:3612246 Length:1342 Species:Mus musculus


Alignment Length:278 Identity:98/278 - (35%)
Similarity:146/278 - (52%) Gaps:36/278 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 LNP----KP-ECGVPRTAQNTLQK--RIIGGRPAQFAEYPWQAHIRIA-EYQCGGVLISANMVAT 178
            |:|    || |||    |:..:.|  ||:||..|...|.||||.::.. .:.||..::....:.:
Mouse   734 LHPSTTAKPQECG----ARPAMDKPTRIVGGISAVSGEVPWQASLKEGPRHFCGATVVGDRWLLS 794

  Fly   179 AAHCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKL 243
            ||||.....:..:..:||.:....:|    ..|| |.|:.:..:|||:|..:..   :|:|||:|
Mouse   795 AAHCFNHTKVEQVQAHLGTVSLLGVG----GSPV-KLGLRRVALHPRYNPGILD---FDVALLEL 851

  Fly   244 AQPTSFTEHILPICLP----QYPIRLIGRKGLIAGWGKTEAHMGHA-GTNMLQVASVPIITTLDC 303
            |||..|.::|.|:|||    ::|   :|||.:|:|||..:.  |:| ..::||.|||.||....|
Mouse   852 AQPLVFNKYIQPVCLPLAIHKFP---VGRKCMISGWGNMQE--GNATKPDILQKASVGIIEQKMC 911

  Fly   304 IRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKER-GRFVLVGITSAGFGCGVDHQP 367
                 ....|..:...|.|||..:|.:|:|.|||||||..:|. |.|.|.||.|.|.||....:|
Mouse   912 -----GALYNFSLTDRMLCAGFLEGRVDSCQGDSGGPLACEETPGVFYLAGIVSWGIGCAQAKKP 971

  Fly   368 GIYHNVQKTVRWIQEVVA 385
            |:|..:.:...||.:.::
Mouse   972 GVYARITRLKDWILKAMS 989

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 87/245 (36%)
Tryp_SPc 142..383 CDD:238113 88/247 (36%)
Tmprss9XP_006513905.2 SEA 285..365 CDD:366610
LDLa 407..442 CDD:238060
Tryp_SPc 455..684 CDD:214473
Tryp_SPc 756..984 CDD:214473 87/245 (36%)
Tryp_SPc 1085..1336 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.