DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and CG11836

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:268 Identity:93/268 - (34%)
Similarity:142/268 - (52%) Gaps:24/268 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 DDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAA 180
            :::.|.|...:||.     :..:.||:||:|....:|||.|.|.. .::.|||.|::.:.|.:||
  Fly    77 ENSSLKNCDCDCGF-----SNEEIRIVGGKPTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAA 136

  Fly   181 HCIQQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY--DIALLKL 243
            ||:::...:.|.|..|:.|.:    |.......:..|...|.|..|:     ||.|  |||||:|
  Fly   137 HCVKKLRKSKIRVIFGDHDQE----ITSESQAIQRAVTAVIKHKSFD-----PDTYNNDIALLRL 192

  Fly   244 AQPTSFTEHILPICLPQYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHE 308
            .:|.||::.|.|||||:|.....||.|.:.|||:|..  |....:::....|||::..:|   ..
  Fly   193 RKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSE--GGELPSIVNQVKVPIMSITEC---RN 252

  Fly   309 SKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNV 373
            .:..:..|.:.|.|||...  ||:|.|||||||::....::.:|||.|.|.|||.:..||:|..|
  Fly   253 QRYKSTRITSSMLCAGRPS--MDSCQGDSGGPLLLSNGVKYFIVGIVSWGVGCGREGYPGVYSRV 315

  Fly   374 QKTVRWIQ 381
            .|.:.||:
  Fly   316 SKFIPWIK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 87/241 (36%)
Tryp_SPc 142..383 CDD:238113 88/243 (36%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.910

Return to query results.
Submit another query.