DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and CG6462

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:261 Identity:78/261 - (29%)
Similarity:120/261 - (45%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 LQKRIIGGRPAQFAEYPWQAHIRI----AE-YQCGGVLISANMVATAAHCIQQAHLADITVYLGE 197
            ::.||.||..|....:|:|..:.|    |: .:|||.||:...|.|||||:..|..|.|  |.|.
  Fly    73 VRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKI--YTGA 135

  Fly   198 LDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLP--- 259
            ....|:....|.|.|.....   ||:|.:   :......|:||::|.:....:|.:.||.|.   
  Fly   136 TVFADVEDSVEELQVTHRDF---IIYPDY---LGFGGYSDLALIRLPRKVRTSEQVQPIELAGEF 194

  Fly   260 QYPIRLIGRKGLIAGWGKTEAHMGHA---GTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMF 321
            .:...|:|:...::|||    ::|.:   .|.:||.....:|....||.:.....::   :....
  Fly   195 MHQNFLVGKVVTLSGWG----YLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVS---QRRHL 252

  Fly   322 CAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGF--GCGVDHQPGIYHNVQKTVRWIQEVV 384
            |...|:|. .||.||||||:|...|....|:|:||.|.  ||.|. .|.:|..:...:.||::..
  Fly   253 CTDGSNGR-GACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVG-GPTVYTRITAYLPWIRQQT 315

  Fly   385 A 385
            |
  Fly   316 A 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 75/251 (30%)
Tryp_SPc 142..383 CDD:238113 76/253 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 75/251 (30%)
Tryp_SPc 77..314 CDD:238113 76/253 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.