DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss4

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_038937788.1 Gene:Tmprss4 / 367074 RGDID:1305033 Length:478 Species:Rattus norvegicus


Alignment Length:259 Identity:89/259 - (34%)
Similarity:131/259 - (50%) Gaps:23/259 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHLAD 190
            :||  ::.:.|   |::||..|....:|||..|:. .::.|||.::..:.:.|||||.::  ..|
  Rat   236 DCG--KSLKTT---RVVGGVEASADSWPWQVSIQYNKQHVCGGSILDHHWILTAAHCFRK--YLD 293

  Fly   191 ITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILP 255
            ::.:.....:..||: ...|||.|..:.:.  :|      .||...||||:||..|.:|:..:.|
  Rat   294 VSSWKVRAGSNKLGN-SPSLPVAKIFIAEP--NP------LQPKEKDIALVKLKMPLTFSGSVRP 349

  Fly   256 ICLPQYPIRLIGRKGL-IAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAE 319
            ||||.....||....: :.|||.||.:.|.....:|| |||.:|   |..|.:.......|:.|.
  Rat   350 ICLPFSDEELIPTMPVWVIGWGFTEENGGKMSDTLLQ-ASVQVI---DSARCNAEDAYQGEVTAG 410

  Fly   320 MFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEV 383
            |.|||...|..|.|.|||||||:. ...::.:|||.|.|:|||....||:|..|...:.||..|
  Rat   411 MLCAGTPQGGKDTCQGDSGGPLMY-HYDKWQVVGIVSWGYGCGSPSTPGVYTKVTAYLDWIYNV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 83/240 (35%)
Tryp_SPc 142..383 CDD:238113 84/242 (35%)
Tmprss4XP_038937788.1 LDLa 99..133 CDD:238060
SRCR_2 149..238 CDD:413346 0/1 (0%)
Tryp_SPc 245..470 CDD:214473 83/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.