DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and PRSS41

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:406 Identity:111/406 - (27%)
Similarity:160/406 - (39%) Gaps:120/406 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LCLLLLICQSSPSQANILNTLLGVPAEC-VHQSGVWPCKLSFSCWLQGGKHAKGCGSNKWLFSCC 72
            |.|.||:.::.          ||.|.|. ..|:|            .|.....|.|..:..| .|
Human     7 LLLALLLARAG----------LGKPGELGALQAG------------PGAARRPGGGGREGHF-LC 48

  Fly    73 VAETQHPHQQQHHSPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNT 137
            .||:|                                        :.|||:  ..||     ...
Human    49 PAESQ----------------------------------------EEELLS--EACG-----HRE 66

  Fly   138 LQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHL-ADITVYLGELDT 200
            :...:.||..:....:||||.:|: ..::|||.|:|...|.:||||.|:.:. ::.||.||||.:
Human    67 IHALVAGGVESARGRWPWQASLRLRRRHRCGGSLLSRRWVLSAAHCFQKHYYPSEWTVQLGELTS 131

  Fly   201 QDLGHIHEPLPVEKHGVLQKIIHPRFNFR-----------MTQPD-----RYDIALLKLAQPTSF 249
            :       |.|              :|.|           :..||     |.|||||:||...::
Human   132 R-------PTP--------------WNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASSVTY 175

  Fly   250 TEHILPICLPQYPIRLIGRKGL-IAGWGKTEAHMGHAGTNM-----LQVASVPIITTLDCIRWHE 308
            ..:|.|||:.......:.|... :.|||.    :..:||.:     |:.|.|.|:....|....|
Human   176 NAYIQPICIESSTFNFVHRPDCWVTGWGL----ISPSGTPLPPPYNLREAQVTILNNTRCNYLFE 236

  Fly   309 SKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNV 373
            .......|...|||||..||.:|.|.||||||||..:.|.:..|||.|.|..||..::||:|.|:
Human   237 QPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNI 301

  Fly   374 QKTVRWIQEVVARNEP 389
            .....||:.|::.:.|
Human   302 SVYFHWIRRVMSHSTP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 84/262 (32%)
Tryp_SPc 142..383 CDD:238113 86/264 (33%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.