DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and TMPRSS9

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001382442.1 Gene:TMPRSS9 / 360200 HGNCID:30079 Length:1093 Species:Homo sapiens


Alignment Length:319 Identity:102/319 - (31%)
Similarity:156/319 - (48%) Gaps:61/319 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKP----------ECGVPRTAQNTLQK 140
            ||.||:.             |.|.:.|       :.|:..|          |||    |:..::|
Human   494 SPESPVV-------------STPTKSM-------QALSTVPLDWVTVPKLQECG----ARPAMEK 534

  Fly   141 --RIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQD 202
              |::||..|...|.|||..::. :.:.||..::....:.:||||.....:..:..:||......
Human   535 PTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLLSAAHCFNHTKVEQVRAHLGTASLLG 599

  Fly   203 LGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLP----QYPI 263
            ||    ..|| |.|:.:.::||.:|..:..   :|:|:|:||.|.:|.::|.|:|||    ::| 
Human   600 LG----GSPV-KIGLRRVVLHPLYNPGILD---FDLAVLELASPLAFNKYIQPVCLPLAIQKFP- 655

  Fly   264 RLIGRKGLIAGWGKTEAHMGHA-GTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSD 327
              :|||.:|:|||.|:.  |:| ...:||.|||.||....|     |...|..:...|.|||..:
Human   656 --VGRKCMISGWGNTQE--GNATKPELLQKASVGIIDQKTC-----SVLYNFSLTDRMICAGFLE 711

  Fly   328 GHMDACLGDSGGPLVIKER-GRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVVA 385
            |.:|:|.|||||||..:|. |.|.|.||.|.|.||....:||:|..:.:...||.|:::
Human   712 GKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGIGCAQVKKPGVYTRITRLKGWILEIMS 770

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/245 (35%)
Tryp_SPc 142..383 CDD:238113 86/247 (35%)
TMPRSS9NP_001382442.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.