DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Np

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001246213.1 Gene:Np / 35904 FlyBaseID:FBgn0265011 Length:1041 Species:Drosophila melanogaster


Alignment Length:308 Identity:95/308 - (30%)
Similarity:145/308 - (47%) Gaps:51/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 SPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQF 150
            :|::.|.. |||           |.:..||      :.|:|              ||:||..|.|
  Fly   774 APANALEG-VDY-----------KEVCGRR------MFPEP--------------RIVGGANAAF 806

  Fly   151 AEYPWQAHI---RIAEY--QCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQDLGHIHEPL 210
            ..:|||..:   |.:.|  :||..|::.|...|||||:.....:|:.:.|||   .||....||.
  Fly   807 GRWPWQISLRQWRTSTYLHKCGAALLNENWAITAAHCVDNVPPSDLLLRLGE---YDLAEEEEPY 868

  Fly   211 PVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGRKGLIAGW 275
            ..::..|.....||:|:.|..:   ||:|||:..:|..|..:|:|:|:|......||:...:.||
  Fly   869 GYQERRVQIVASHPQFDPRTFE---YDLALLRFYEPVIFQPNIIPVCVPDNDENFIGQTAFVTGW 930

  Fly   276 GKTEAHMGHAG--TNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSG 338
            |:    :...|  .::||..:||:|....|...:.|......|.....|||...|..|:|.||||
  Fly   931 GR----LYEDGPLPSVLQEVAVPVINNTICESMYRSAGYIEHIPHIFICAGWKKGGYDSCEGDSG 991

  Fly   339 GPLVIKERG--RFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVV 384
            ||:|::...  ||.|.|:.|.|.||...:|||:|..:.:...||.:::
  Fly   992 GPMVLQRESDKRFHLGGVISWGIGCAEANQPGVYTRISEFRDWINQIL 1039

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 83/247 (34%)
Tryp_SPc 142..383 CDD:238113 84/249 (34%)
NpNP_001246213.1 Tryp_SPc 797..1035 CDD:214473 83/247 (34%)
Tryp_SPc 798..1038 CDD:238113 84/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
33.010

Return to query results.
Submit another query.