DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Corin

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_610297.2 Gene:Corin / 35691 FlyBaseID:FBgn0033192 Length:1397 Species:Drosophila melanogaster


Alignment Length:371 Identity:111/371 - (29%)
Similarity:168/371 - (45%) Gaps:66/371 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GSNKWLFSCCVAETQHPHQQQHHSPSSPLANLVDYGKLKLN--LNSLPKRIML------------ 113
            |..:|:.:|.      .:..:..|||: :.:::.|..:...  |..|..|.:|            
  Fly  1000 GQRQWMPACV------KNWDRAVSPSA-VCSILGYSAVNATSVLTQLTHRPLLATVNVSTDIWKM 1057

  Fly   114 --RRRDD--NELLNPKP--------------ECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHI- 159
              :|:..  .|..|.|.              |||..:..::...:|||||..|....:|:.|.| 
  Fly  1058 YAKRKSTLMQEFANCKKTEDYPMADLTCSNYECGRVKRGRHKPSRRIIGGTQASPGNWPFLAAIL 1122

  Fly   160 ----RIAEYQCGGVLISANMVATAAHCIQQAHLADI---TVYLGELDTQDLGHIHEPLPVEKHGV 217
                :|  :.|.|||||...|.||:||:....:.|:   |:.||........:..:.:.|:    
  Fly  1123 GGPEKI--FYCAGVLISDQWVLTASHCVGNYSVIDLEDWTIQLGVTRRNSFTYSGQKVKVK---- 1181

  Fly   218 LQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLI--GRKGLIAGWGKTEA 280
             ..|.||::|..:...:  ||||.:||...:|.||:||:|||...:|.:  |....:.||||.|.
  Fly  1182 -AVIPHPQYNMAIAHDN--DIALFQLATRVAFHEHLLPVCLPPPSVRNLHPGTLCTVIGWGKRED 1243

  Fly   281 HMGHAGTN-MLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIK 344
            ....:... ::....|||||...|..|.:    |:.:...|.|||..||..|||.|||||||:..
  Fly  1244 KDPKSTYEYIVNEVQVPIITRNQCDEWLD----NLTVSEGMVCAGFDDGGKDACQGDSGGPLLCP 1304

  Fly   345 ---ERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVVARN 387
               |:.|:.:.||.|.|..|.....||:|.||.:.|.||||.:|::
  Fly  1305 YPGEKNRWFVGGIVSWGIMCAHPRLPGVYANVVQYVPWIQEQIAKH 1350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 88/252 (35%)
Tryp_SPc 142..383 CDD:238113 90/254 (35%)
CorinNP_610297.2 CRD_FZ 778..894 CDD:143549
LDLa 911..942 CDD:238060
LDLa 945..979 CDD:238060
SR 980..>1034 CDD:214555 7/40 (18%)
SRCR 992..1086 CDD:278931 15/92 (16%)
Tryp_SPc 1103..1343 CDD:214473 88/252 (35%)
Tryp_SPc 1104..1346 CDD:238113 90/254 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.