DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and PRSS48

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:267 Identity:90/267 - (33%)
Similarity:126/267 - (47%) Gaps:25/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAHLA-D 190
            ||.|     ....|::||:.|....:|||..:.. ..:.|||.|:|..::.|||||||..... .
Human    42 CGQP-----VYSSRVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFS 101

  Fly   191 ITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILP 255
            .||:||.:...|      .....|:.|.:.:|||::     |....|:|||||:...:||..|||
Human   102 YTVWLGSITVGD------SRKRVKYYVSKIVIHPKY-----QDTTADVALLKLSSQVTFTSAILP 155

  Fly   256 ICLPQYPIRL-IGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHES-----KQINV 314
            ||||....:| |.....:.||||.:........:.||.|.||||....|.:.:..     ..:..
Human   156 ICLPSVTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEP 220

  Fly   315 EIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRW 379
            .||.:..|||.:....|:|.|||||||.....|.::..|:.|.|..|| ...||:|.||....:|
Human   221 VIKEDKICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLECG-KSLPGVYTNVIYYQKW 284

  Fly   380 IQEVVAR 386
            |...::|
Human   285 INATISR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 84/246 (34%)
Tryp_SPc 142..383 CDD:238113 85/248 (34%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 84/246 (34%)
Tryp_SPc 51..288 CDD:238113 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450300at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.