DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and tmprss4b

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001119849.1 Gene:tmprss4b / 327651 ZFINID:ZDB-GENE-030131-5862 Length:432 Species:Danio rerio


Alignment Length:256 Identity:91/256 - (35%)
Similarity:135/256 - (52%) Gaps:30/256 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 QKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCI--QQAHLADITVYLGELDT 200
            :.||:||.......:|||..::. ..:.|||.|:|.:.:.:||||.  :...|:..||.||:...
Zfish   199 EDRIVGGVETSIEHWPWQVSLQFNHRHMCGGSLLSTSWIISAAHCFTGRTQELSRWTVVLGQTKV 263

  Fly   201 QDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRL 265
            .|:..:         .|...:||..:| |:|  :.:|||:|||..|....|.|||:|||.:.:.:
Zfish   264 MDVVGV---------SVDMIVIHKDYN-RLT--NDFDIAMLKLTWPVKTGESILPVCLPPHQLAI 316

  Fly   266 IGRKGL--IAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQ--INVEIKAEMFCAGHS 326
               |.:  :.|||..:.  |.|...:||.||||::...:|     ||.  .:..|...|.|||..
Zfish   317 ---KDMLVVTGWGLLKE--GGALPTVLQKASVPLVNRSEC-----SKPTIYSSSITPRMLCAGFL 371

  Fly   327 DGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVVARN 387
            .|::|||.||||||||... .|:.|:||.|.|.||..:.:||:|.:|.:.:.||..|:.||
Zfish   372 QGNVDACQGDSGGPLVYLS-SRWQLIGIVSWGVGCAREGKPGVYADVTQLLDWIYTVMERN 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 86/245 (35%)
Tryp_SPc 142..383 CDD:238113 87/247 (35%)
tmprss4bNP_001119849.1 SRCR_2 100..179 CDD:292133
SRCR 105..>175 CDD:278931
Tryp_SPc 201..424 CDD:214473 86/245 (35%)
Tryp_SPc 202..427 CDD:238113 87/247 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.