DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and HPN

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001362370.1 Gene:HPN / 3249 HGNCID:5155 Length:417 Species:Homo sapiens


Alignment Length:410 Identity:116/410 - (28%)
Similarity:172/410 - (41%) Gaps:109/410 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLCLCLLLLICQSSPSQANILNTLLGVPAECVHQSGVWPCKLSFSCWLQGGKHA----KGCGSNK 66
            |..||       ||.|.|.:    .|:..|          ::.|   |:...|:    :..|:|.
Human    73 WRLLC-------SSRSNARV----AGLSCE----------EMGF---LRALTHSELDVRTAGANG 113

  Fly    67 WLFSCCVAETQHPHQQQHHSPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVP 131
            .....||.|.:.||.|:                                     ||.....|..|
Human   114 TSGFFCVDEGRLPHTQR-------------------------------------LLEVISVCDCP 141

  Fly   132 R------TAQNTLQK-----RIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQ 184
            |      ..|:..::     ||:|||......:|||..:|. ..:.|||.|:|.:.|.|||||..
Human   142 RGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFP 206

  Fly   185 QAH--LADITVYLGELDTQDLGHIHEPLPVEKHGV---LQKIIH-----PRFNFRMTQPDRYDIA 239
            :.:  |:...|:.|.:           .....||:   :|.:::     | |....::.:..|||
Human   207 ERNRVLSRWRVFAGAV-----------AQASPHGLQLGVQAVVYHGGYLP-FRDPNSEENSNDIA 259

  Fly   240 LLKLAQPTSFTEHILPICLPQYPIRLI-GRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDC 303
            |:.|:.|...||:|.|:|||.....|: |:...:.|||.|:.:...||  :||.|.||||:...|
Human   260 LVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQYYGQQAG--VLQEARVPIISNDVC 322

  Fly   304 IRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLV----IKERGRFVLVGITSAGFGCGVD 364
               :.:.....:||.:|||||:.:|.:|||.||||||.|    |....|:.|.||.|.|.||.:.
Human   323 ---NGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCEDSISRTPRWRLCGIVSWGTGCALA 384

  Fly   365 HQPGIYHNVQKTVRWIQEVV 384
            .:||:|..|.....||.:.:
Human   385 QKPGVYTKVSDFREWIFQAI 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 88/254 (35%)
Tryp_SPc 142..383 CDD:238113 89/256 (35%)
HPNNP_001362370.1 Hepsin-SRCR 51..159 CDD:401275 26/146 (18%)
Tryp_SPc 163..400 CDD:238113 87/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.