DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and CG6048

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:274 Identity:87/274 - (31%)
Similarity:116/274 - (42%) Gaps:54/274 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RIIGGRPAQFAEYPWQAHIRIA---------EYQCGGVLISANMVATAAHCIQQAHLADIT---- 192
            |||.|..|.......|..||.|         .:.|||.||....|.|||||.....:.|.|    
  Fly    45 RIINGTEASLGATRHQVGIRKALNDGYFFGTGHLCGGSLIRPGWVLTAAHCFVDQIIYDGTFVPK 109

  Fly   193 ----VYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRF----NFRMTQPDRYDIALLKLAQPTSF 249
                |.:|.||..:           :...|...|..|.    .|.::..|: |||||.| ..|..
  Fly   110 EEFIVVMGNLDRYN-----------RTNTLTFTIEERIMQLDKFDLSTYDK-DIALLML-NGTVP 161

  Fly   250 TEH--ILPICLPQYPIRLIGRKGL---IAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHES 309
            |.|  |.||.|.::.|    .:|:   :.|||.||.  |:. :::|....||:|:...||   ..
  Fly   162 TGHPTIRPIALNRFAI----PEGVVCQVTGWGNTED--GYV-SDILMTVDVPMISEEHCI---ND 216

  Fly   310 KQINVEIKAEMFCAGHSD-GHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNV 373
            ..:...|:..|.|||:.: |..|||.||||||||.:..    |.|:.|.|..|.:...||:|..|
  Fly   217 SDLGHLIQPGMICAGYLEVGEKDACAGDSGGPLVCQSE----LAGVVSWGIQCALPRLPGVYTEV 277

  Fly   374 QKTVRWIQEVVARN 387
            .....||.:.:..|
  Fly   278 SYYYDWILQNMGEN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 84/265 (32%)
Tryp_SPc 142..383 CDD:238113 85/267 (32%)
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 84/265 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.