DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss3

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_038954650.1 Gene:Tmprss3 / 309665 RGDID:1310135 Length:454 Species:Rattus norvegicus


Alignment Length:268 Identity:98/268 - (36%)
Similarity:141/268 - (52%) Gaps:31/268 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 CGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRIAEYQ-CGGVLISANMVATAAHCIQQA-HLAD 190
            ||: ||..:   .||:||..:...::|||..::...|. |||.:|:...:.|||||:... |...
  Rat   207 CGM-RTGYS---PRIVGGNVSSLTQWPWQVSLQFQGYHLCGGSVITPLWIVTAAHCVYDLYHPKS 267

  Fly   191 ITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRY--DIALLKLAQPTSFTEHI 253
            .||.:|.:...|       .||..|.|.:.|.|.::     :|.|.  ||||:||::|.:|.|.|
  Rat   268 WTVQVGLVSLMD-------SPVPSHLVEKIIYHSKY-----KPKRLGNDIALMKLSEPLTFDETI 320

  Fly   254 LPICLP----QYPIRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINV 314
            .|||||    .:|   .|:....:|||.||...|.| :.:|..|:||:|:...|.  |......:
  Rat   321 QPICLPNSEENFP---DGKLCWTSGWGATEDGAGDA-SPVLNHAAVPLISNKICN--HRDVYGGI 379

  Fly   315 EIKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRW 379
             |...|.|||:..|.:|:|.||||||||.:||..:.|||.||.|.||...::||:|..:...:.|
  Rat   380 -ISPSMLCAGYLKGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDW 443

  Fly   380 IQEVVARN 387
            |.|.:.|:
  Rat   444 IHEQLERD 451

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 90/246 (37%)
Tryp_SPc 142..383 CDD:238113 91/248 (37%)
Tmprss3XP_038954650.1 LDLa 74..107 CDD:238060
SRCR_2 112..211 CDD:406055 2/4 (50%)
Tryp_SPc 216..444 CDD:214473 90/246 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.