DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Prss22

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:264 Identity:90/264 - (34%)
Similarity:137/264 - (51%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 PECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHI-RIAEYQCGGVLISANMVATAAHCIQQAHLA 189
            |:||.|:..     .|::||..:..|::||...| :...:.|.|.|::...|.:||||. .:::.
  Rat    39 PDCGKPQQL-----NRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRWVVSAAHCF-SSNMD 97

  Fly   190 DITVYLGELDTQDLGHIHEPLP-VEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHI 253
            ..:.|...|....||:   |.| .:|.|:...:.|||::.:  :....||||::|.:|..|:|.|
  Rat    98 KPSPYSVLLGAWKLGN---PGPRSQKVGIASVLPHPRYSRK--EGTHADIALVRLERPIQFSERI 157

  Fly   254 LPICLPQYPIRLIGRKGL-IAGWGKTEAHMGHAGTNMLQVASVPIITTLDC--IRWHESKQINVE 315
            ||||||...:.|...... |||||..:..:.......||...||||....|  :.|..:.|  ..
  Rat   158 LPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKSLYWRGAGQ--EA 220

  Fly   316 IKAEMFCAGHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380
            |..:|.|||:.:|..|||||||||||:.:....::|.||.|.|.||...::||:|.::.....|:
  Rat   221 ITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVYTSLLAHRPWV 285

  Fly   381 QEVV 384
            |.:|
  Rat   286 QRIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 83/243 (34%)
Tryp_SPc 142..383 CDD:238113 84/245 (34%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 83/243 (34%)
Tryp_SPc 50..288 CDD:238113 84/245 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.