DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss13

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:425 Identity:120/425 - (28%)
Similarity:178/425 - (41%) Gaps:91/425 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLWLCLCLLLL---------ICQSSPSQANILNTLLGVPAECVHQSGVWPCKL---SFSC---- 51
            ||:.|.:.|:||         |....|        |...|...|...||..||:   ...|    
  Rat   146 LLISLVISLILLFYFWRGHTGIKYKEP--------LESCPKHAVRCDGVVDCKMKSDELGCVRFD 202

  Fly    52 WLQGGKHAKGCGSNKWLFSCCVA----ETQHPHQQ------------QHHSPSSPLANLVDYGKL 100
            |.:.........|.:||..|..:    :::...||            .|...:|... |.:|...
  Rat   203 WDKSLLKVYSGSSGEWLPVCSSSWNDTDSERTCQQLGFDSAYRTTEVAHRDVTSSFL-LSEYNST 266

  Fly   101 ---KLNLNSLPKR--IMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIR 160
               .|..:..|.|  :.|:          ...||:     ..:..||:||.....:::|||..:.
  Rat   267 IQESLTRSECPSRRYVSLQ----------CAHCGL-----RAMTGRIVGGALTSESKWPWQVSLH 316

  Fly   161 I-AEYQCGGVLISANMVATAAHCI---QQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKI 221
            . ..:.|||.||.|..|.|||||.   ::..|....||.|      ..::|: || |...:.|.|
  Rat   317 FGTTHICGGTLIDAQWVLTAAHCFFVTREKILEGWKVYAG------TSNLHQ-LP-EAASISQII 373

  Fly   222 IHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGRK-GL-----IAGWGKTEA 280
            |:..:.   .:.|.|||||::|::|.:.:.||.|.|||     |.|:. ||     |.|:|||: 
  Rat   374 INGNYT---DEQDDYDIALVRLSKPLTLSAHIHPACLP-----LHGQTFGLNETCWITGFGKTK- 429

  Fly   281 HMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVIKE 345
            ......:..|:...|.:|....|   ::....:..:...|.|||...|..|:|.||||||||.::
  Rat   430 ETDEKTSPFLREVQVNLIDFKKC---NDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCEQ 491

  Fly   346 RGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380
            ..|:.|.|:||.|.|||..::||:|..|.:.:.||
  Rat   492 NNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWI 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/248 (34%)
Tryp_SPc 142..383 CDD:238113 86/249 (35%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133 17/104 (16%)
SRCR 216..288 CDD:278931 13/82 (16%)
Tryp_SPc 297..526 CDD:214473 85/248 (34%)
Tryp_SPc 298..526 CDD:238113 84/247 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.