DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Prss30

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:259 Identity:90/259 - (34%)
Similarity:132/259 - (50%) Gaps:27/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 RIIGGRPAQFAEYPWQAHIRIAE--YQCGGVLISANMVATAAHCI-QQAHLADITVYLGELDTQD 202
            :|:||:.|....:|||..:|..:  :.|||.||....|.|||||. :..:.:...|.:|.| |..
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGL-TLS 93

  Fly   203 LGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKL---AQPTSFTEHILPICLPQYPIR 264
            |...|..|.    .|....::|.:.:.  .....|||||:|   .||:.|:    |:||||....
  Rat    94 LTEPHSTLV----AVRNIFVYPTYLWE--DASSGDIALLRLDTPLQPSQFS----PVCLPQAQAP 148

  Fly   265 LI-GRKGLIAGWGKT-EAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVE----IKAEMFCA 323
            |. |....:.|||.| |..:    .::||..:||::.:.||.|.:...:.::.    |:::|.||
  Rat   149 LTPGTVCWVTGWGATHEREL----ASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCA 209

  Fly   324 GHSDGHMDACLGDSGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVVARN 387
            |..:|..|:|.||||||||......::.|||||.|.||...::||:|..|...|.|||..:|.|
  Rat   210 GFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWIQRTLAEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 85/250 (34%)
Tryp_SPc 142..383 CDD:238113 88/252 (35%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450300at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.