DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and Tmprss13

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:428 Identity:119/428 - (27%)
Similarity:180/428 - (42%) Gaps:84/428 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLLWLCLCLLLLI----CQSSPSQA----------NILNTLLGVPAECVHQSGVWPCKL---SFS 50
            ||:.|.:.|:||.    .||....|          .....|...|...|...||..||:   ...
Mouse   155 LLISLVISLILLYGGRETQSPRGTAVYFWRGHTGIKYKEPLESCPIHAVRCDGVVDCKMKSDELG 219

  Fly    51 C----WLQGGKHAKGCGSNKWLFSCCVA----ETQHPHQQ------------QHHSPSSPLANLV 95
            |    |.:.........|.:||..|..:    :::...||            .|...:|... |.
Mouse   220 CVRFDWDKSLLKVYSGSSGEWLPVCSSSWNDTDSKRTCQQLGFDSAYRTTEVAHRDITSSFL-LS 283

  Fly    96 DYG---KLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGGRPAQFAEYPWQA 157
            :|.   :..|..:..|.|..:..:..:        ||:     ..:..||:||.....:::|||.
Mouse   284 EYNTTIQESLYRSQCPSRRYVSLQCSH--------CGL-----RAMTGRIVGGALTSESKWPWQV 335

  Fly   158 HIRI-AEYQCGGVLISANMVATAAHCI---QQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVL 218
            .:.. ..:.|||.||.|..|.|||||.   ::..|....||.|      ..::|: || |...:.
Mouse   336 SLHFGTTHICGGTLIDAQWVLTAAHCFFVTREKLLEGWKVYAG------TSNLHQ-LP-EAASIS 392

  Fly   219 QKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGRK-GL-----IAGWGK 277
            |.||:..:.   .:.|.|||||::|::|.:.:.||.|.|||.:     |:. ||     |.|:||
Mouse   393 QIIINGNYT---DEQDDYDIALIRLSKPLTLSAHIHPACLPMH-----GQTFGLNETCWITGFGK 449

  Fly   278 TEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLV 342
            |: ......:..|:...|.:|....|   ::....:..:...|.|||...|..|:|.||||||||
Mouse   450 TK-ETDEKTSPFLREVQVNLIDFKKC---NDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLV 510

  Fly   343 IKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380
            .::..|:.|.|:||.|.|||..::||:|..|.:.:.||
Mouse   511 CEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWI 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 84/248 (34%)
Tryp_SPc 142..383 CDD:238113 85/249 (34%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060 4/15 (27%)
SRCR_2 225..314 CDD:373897 16/102 (16%)
Tryp_SPc 319..548 CDD:214473 84/248 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.