DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and svh-1

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:273 Identity:87/273 - (31%)
Similarity:128/273 - (46%) Gaps:33/273 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ECGV------PRTAQNTLQKRIIGGRPAQFAEYPWQAHIR---IAEYQCGGVLISANMVATAAHC 182
            :||:      .|.|..:...|::||.......:||.|.:|   ...:.||..::....:.|||||
 Worm   692 QCGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALRNKATKAHHCGASILDKTHLITAAHC 756

  Fly   183 IQQ-AHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPD--RYDIALLKLA 244
            .:: ..::...|.:|:.|..           :..|..|.....|.:|.....|  .:|||:|::.
 Worm   757 FEEDERVSSYEVVVGDWDNN-----------QTDGNEQIFYLQRIHFYPLYKDIFSHDIAILEIP 810

  Fly   245 QP-TSFTEHILPICLPQYP-IRLIGRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWH 307
            .| ..|.|:..|||||... :...||:.:::|||.    ||......||.|.:|||...||:   
 Worm   811 YPGIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGS----MGLRYAERLQAALIPIINRFDCV--- 868

  Fly   308 ESKQINVEIKAEMFCAGHSDGHMDACLGDSGGPLVI-KERGRFVLVGITSAGFGCGVDHQPGIYH 371
            .|.||...:....||||:.:|.:|:|.||||||... :|.|.|||.|:.|.|.||....|||||.
 Worm   869 NSSQIYSSMSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYT 933

  Fly   372 NVQKTVRWIQEVV 384
            .|...:.||..::
 Worm   934 MVAPYLSWISAII 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 81/247 (33%)
Tryp_SPc 142..383 CDD:238113 82/249 (33%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 82/249 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.