DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:299 Identity:94/299 - (31%)
Similarity:145/299 - (48%) Gaps:45/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LKLNL---NSLPKRIMLRR--RDDNELLNPKPECGVPRTAQNTL--QKRIIGGRPAQFAEYPWQA 157
            ||.|:   |::|..|.|..  :..:|:|.... ||  |...|::  ..:|:.|:.:....:||||
Human   139 LKNNMASWNAVPASIKLMEISKAASEMLTNNC-CG--RQVANSIITGNKIVNGKSSLEGAWPWQA 200

  Fly   158 HIR-IAEYQCGGVLISANMVATAAHCI-QQAHLADITVYLGELDTQDLGHIHEPLPVEKHGVLQK 220
            .:: ...:.||..|||:..:.:||||. ::.:..|.||..|.:       :::|....|   :|.
Human   201 SMQWKGRHYCGASLISSRWLLSAAHCFAKKNNSKDWTVNFGIV-------VNKPYMTRK---VQN 255

  Fly   221 IIHPRFNFRMTQPDRY-DIALLKLAQPTSFTEHILPICLPQYPIRLIGRKG-LIAGWGKTEAHMG 283
            ||   |:...:.|..: ||||::||:..||||:|..||||:..::|..... ::.|||       
Human   256 II---FHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMKLSENDNVVVTGWG------- 310

  Fly   284 HAGTNMLQVASVPIITTLDCIRWHESKQINVE------IKAEMFCAGHSDGHMDACLGDSGGPLV 342
                .:....|.|:|...|.::..::|..|..      :...|.|||...|..|||..||||||.
Human   311 ----TLYMNGSFPVILQEDFLKIIDNKICNASYAYSGFVTDTMLCAGFMSGEADACQNDSGGPLA 371

  Fly   343 IKE-RGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWI 380
            ..: |..:.||||.|.|.|||..::||:|..|.....||
Human   372 YPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWI 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 79/249 (32%)
Tryp_SPc 142..383 CDD:238113 81/250 (32%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699 2/3 (67%)
Tryp_SPc 184..410 CDD:214473 79/249 (32%)
Tryp_SPc 185..413 CDD:238113 81/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.