DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13744 and hpn

DIOPT Version :9

Sequence 1:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster
Sequence 2:XP_012811934.1 Gene:hpn / 100145343 XenbaseID:XB-GENE-995348 Length:417 Species:Xenopus tropicalis


Alignment Length:266 Identity:91/266 - (34%)
Similarity:142/266 - (53%) Gaps:29/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 ECGVPRTAQNTLQKRIIGGRPAQFAEYPWQAHIRI-AEYQCGGVLISANMVATAAHCIQQAH--L 188
            :||..:.|.:    ||:||:.|....:|||..:|. ..:.|||.|||:..|.|||||..:.:  :
 Frog   152 DCGRRKLAVD----RIVGGQDATLGRWPWQVSLRYDGAHLCGGSLISSEWVLTAAHCFPERNRIV 212

  Fly   189 ADITVYLGELDTQDLGHIHEPLPVEKHGVLQKIIHPRFNFRMTQPD----RYDIALLKLAQPTSF 249
            :...|:.|.        :.:..|..|...::.||:.........||    ..||||:.||.|.:.
 Frog   213 SQWRVFAGA--------VSQLSPRGKLLGVKGIIYHSGYLPFLNPDSEENSNDIALVHLASPVTL 269

  Fly   250 TEHILPICLPQYPIRLI-GRKGLIAGWGKTEAHMGHAGTNMLQVASVPIITTLDCIRWHESKQIN 313
            :|:|.|:|||....::| |:...::|||..: :.|.. :.:||.||||||::..|   ::.:...
 Frog   270 SEYIQPVCLPALGQQIIDGKICTVSGWGNLQ-YYGQQ-SEILQEASVPIISSSVC---NQPEYYM 329

  Fly   314 VEIKAEMFCAGHSDGHMDACLGDSGGPLV----IKERGRFVLVGITSAGFGCGVDHQPGIYHNVQ 374
            .:|..:|||||:::|.:|||.||||||.|    :....|:.|.||.|.|.||.:.::||:|..|.
 Frog   330 NQITGKMFCAGYAEGGIDACQGDSGGPFVCEDTLSRSSRWRLCGIVSWGIGCAMPNKPGVYAKVD 394

  Fly   375 KTVRWI 380
            :...||
 Frog   395 QYQYWI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 86/250 (34%)
Tryp_SPc 142..383 CDD:238113 87/251 (35%)
hpnXP_012811934.1 Hepsin-SRCR 50..159 CDD:370400 2/6 (33%)
Tryp_SPc 163..400 CDD:238113 85/249 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.