DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TMPRSS11D

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_004253.1 Gene:TMPRSS11D / 9407 HGNCID:24059 Length:418 Species:Homo sapiens


Alignment Length:257 Identity:101/257 - (39%)
Similarity:136/257 - (52%) Gaps:23/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CG---EVYTRS-NRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTP 366
            ||   ::.|.| .||:||.....||.||||:|    .|.....|||:||:|.|::|||||..|  
Human   173 CGAGPDLITLSEQRILGGTEAEEGSWPWQVSL----RLNNAHHCGGSLINNMWILTAAHCFRS-- 231

  Fly   367 NSNMKIRLGEW-DVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVC 430
            |||.:    :| ...|...........:....:|.:|..|...||:||:||:.:|.:.:.|..||
Human   232 NSNPR----DWIATSGISTTFPKLRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVC 292

  Fly   431 LPPSTTKL-TGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLC 494
            ||.:|..: .|..|.|.|||...:...|||. |::..|.:||||.|.......|   ||....||
Human   293 LPAATQNIPPGSTAYVTGWGAQEYAGHTVPE-LRQGQVRIISNDVCNAPHSYNG---AILSGMLC 353

  Fly   495 AGYKDGGRDSCQGDSGGPLTLTMDGRKT--LIGLVSWGIGCGREHLPGVYTNIQRFVPWINK 554
            ||...||.|:||||||||| :..|.|:.  ::|:||||..||....|||||.:..::.||.:
Human   354 AGVPQGGVDACQGDSGGPL-VQEDSRRLWFIVGIVSWGDQCGLPDKPGVYTRVTAYLDWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 95/240 (40%)
Tryp_SPc 316..555 CDD:238113 96/243 (40%)
TMPRSS11DNP_004253.1 SEA 48..143 CDD:279699
Tryp_SPc 186..412 CDD:214473 95/240 (40%)
Tryp_SPc 187..415 CDD:238113 96/243 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.