DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and prss60.1

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:267 Identity:96/267 - (35%)
Similarity:140/267 - (52%) Gaps:33/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CGEVYTRSNRIVGGHSTGFGSHPWQVAL---IKSGFLTRKLSCGGALISNRWVITAAHCVASTPN 367
            || :...:||||||.:...||.||||:|   |..|..     |||:||::.||:|||||:.....
Zfish    25 CG-LAPLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHF-----CGGSLINSEWVLTAAHCLPRITT 83

  Fly   368 SNMKIRLGEWDVRGQEERLNHEEYGIERK----EVHPHYNPADFVNDVALIRLDRNVVYKQHIIP 428
            |::.:.||:...:|.      ..|.|.|.    .|||.||.....||:||:.|...|.:..:|.|
Zfish    84 SSLLVFLGKTTQQGV------NTYEINRTVSVITVHPSYNNLTNENDIALLHLSSAVTFSNYIRP 142

  Fly   429 VCLPPSTTKL-TGKMATVAGWGRTRHGQS-TVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDV 491
            |||....:.. .|..:.:.|||..:.|.: ..|.:|||..:.|:.||:|.....:.    ::.:.
Zfish   143 VCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSG----SVTNN 203

  Fly   492 FLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLI----GLVSWGIGCGREHLPGVYTNIQRFVPWI 552
            .:|||...||||:||||||||    |..::.|:    |:.|||.||...:.|||||.:.::..||
Zfish   204 MICAGLLQGGRDTCQGDSGGP----MVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWI 264

  Fly   553 NKVMAND 559
            |.::..:
Zfish   265 NSIIVQN 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/249 (36%)
Tryp_SPc 316..555 CDD:238113 92/251 (37%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 90/249 (36%)
Tryp_SPc 34..267 CDD:238113 92/251 (37%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587676
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.