DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TPSAB1

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:265 Identity:91/265 - (34%)
Similarity:130/265 - (49%) Gaps:31/265 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSG-----FLTRKLSCGGALISNRWVITAAHCVA 363
            |..|:...|.. ||||........||||:|...|     |      |||:||..:||:||||||.
Human    20 PAPGQALQRVG-IVGGQEAPRSKWPWQVSLRVHGPYWMHF------CGGSLIHPQWVLTAAHCVG 77

  Fly   364 STPN----SNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQ 424
              |:    :.::::|.|..:..|::.|     .:.|..|||.:..|....|:||:.|:..|....
Human    78 --PDVKDLAALRVQLREQHLYYQDQLL-----PVSRIIVHPQFYTAQIGADIALLELEEPVNVSS 135

  Fly   425 HIIPVCLPP-STTKLTGKMATVAGWGRTRHGQSTVPSV-LQEVDVEVISNDRCQRWFRAAGRR-- 485
            |:..|.||| |.|...|....|.|||...:.:...|.. |::|.|.::.|..|...:......  
Human   136 HVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGD 200

  Fly   486 --EAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRF 548
              ..:.|..||||  :..||||||||||||...::|.....|:||||.||.:.:.||:||.:..:
Human   201 DVRIVRDDMLCAG--NTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYY 263

  Fly   549 VPWIN 553
            :.||:
Human   264 LDWIH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 86/251 (34%)
Tryp_SPc 316..555 CDD:238113 88/253 (35%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 87/251 (35%)
Tryp_SPc 31..267 CDD:214473 86/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152879
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.