DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and PRSS22

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:267 Identity:94/267 - (35%)
Similarity:148/267 - (55%) Gaps:15/267 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 DASYRPV-PGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAH 360
            :|:..|| |.||:. .:.||:|||..:.....||.|::.|:|    ...|.|:|:::||||||||
Human    31 NAARIPVPPACGKP-QQLNRVVGGEDSTDSEWPWIVSIQKNG----THHCAGSLLTSRWVITAAH 90

  Fly   361 CVASTPNSN--MKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYN-PADFVNDVALIRLDRNVVY 422
            |.....|..  ..:.||.|.:.....|  .::.|:...|.||.|: ......|:||:||:|::.:
Human    91 CFKDNLNKPYLFSVLLGAWQLGNPGSR--SQKVGVAWVEPHPVYSWKEGACADIALVRLERSIQF 153

  Fly   423 KQHIIPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTV-PSVLQEVDVEVISNDRCQR-WFRAAGR 484
            .:.::|:|||.::..| ......::|||..:.|.... |..||::.|.:|.::.|.. ::|.||:
Human   154 SERVLPICLPDASIHLPPNTHCWISGWGSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQ 218

  Fly   485 REAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFV 549
            .....|: |||||.:|.||:|.|||||||...:||...|.|::|||.||...:.||||.::....
Human   219 GPITEDM-LCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHR 282

  Fly   550 PWINKVM 556
            .|:.|::
Human   283 SWVEKIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 85/242 (35%)
Tryp_SPc 316..555 CDD:238113 85/244 (35%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 85/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S12542
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4849
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.890

Return to query results.
Submit another query.