DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG18735

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:330 Identity:108/330 - (32%)
Similarity:161/330 - (48%) Gaps:39/330 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 LGSISGITNHLDSFFDAESQAPLDSAGAPPPHEPLPNAQAFAVGNVLD----LNAGEAADEYQSG 290
            ||.::..|..|.|              |..|.:.|.|.......:.||    :...|...|:.|.
  Fly    14 LGDLACATPSLRS--------------ASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSP 64

  Fly   291 GSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWV 355
            ......:.|      ||.:.|| :|||||..|....:||.:.|:..|    ...||.:|:::::.
  Fly    65 AKRECAECS------CGNINTR-HRIVGGQETEVHEYPWMIMLMWFG----NFYCGASLVNDQYA 118

  Fly   356 ITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNV 420
            :||||||....:..:.:||.|.:  .|:..:...:..:.|..:||.|:..:|.:|:||||.:..|
  Fly   119 LTAAHCVNGFYHRLITVRLLEHN--RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181

  Fly   421 VYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRR 485
            .....:.|||:|..:....|:.|.|.|||....| ..:...||||:|.::|.:.|    |.:...
  Fly   182 RLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEG-GPISDTLQEVEVPILSQEEC----RNSNYG 241

  Fly   486 EA-IHDVFLCAGY-KDGGRDSCQGDSGGPLTLTMDG-RKTLIGLVSWGIGCGREHLPGVYTNIQR 547
            |: |.|..:|||| :.||:||||||||||:.:...| ...|.|:||||.||.:.:.|||||.:..
  Fly   242 ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306

  Fly   548 FVPWI 552
            |..||
  Fly   307 FNDWI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 87/239 (36%)
Tryp_SPc 316..555 CDD:238113 88/240 (37%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/239 (36%)
Tryp_SPc 83..314 CDD:238113 88/240 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457751
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.740

Return to query results.
Submit another query.