DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:94 Identity:36/94 - (38%)
Similarity:49/94 - (52%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 PSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTL 523
            |..||:..|.|:.|..|.....|     .|.|..:|||...||:|:||||||||:..........
Zfish    13 PRTLQQTVVPVVINSDCNNLLGA-----TITDNMMCAGLLQGGKDTCQGDSGGPMVSQQCSVWVQ 72

  Fly   524 IGLVSWGIGCGREHLPGVYTNIQRFVPWI 552
            .|::|.|..||:.:.|||||.:.::..||
Zfish    73 SGIISKGHDCGQPYEPGVYTRVSQYQNWI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 34/92 (37%)
Tryp_SPc 316..555 CDD:238113 36/94 (38%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 36/94 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.