DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:359 Identity:110/359 - (30%)
Similarity:165/359 - (45%) Gaps:49/359 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSSSSSLNSWEHETGGHLGSISGITNHLDSFFDAESQAPLDSAGAPPPHEPLPNAQAFAVGNVLD 277
            |...|:|...:..||          |...:.||..::|..::|.....:...|..:|..:|...|
Human   107 SKDRSTLQVLDSATG----------NWFSACFDNFTEALAETACRQMGYSSKPTFRAVEIGPDQD 161

  Fly   278 LNAGEAADEYQ------------SGGSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQ 330
            |:..|..:..|            ||.....|..:      ||: ..::.|:||.......|.|||
Human   162 LDVVEITENSQELRMRNSSGPCLSGSLVSLHCLA------CGK-SLKTPRVVGVEEASVDSWPWQ 219

  Fly   331 VALIKSGFLTRKLSCGGALISNRWVITAAHCVAS-TPNSNMKIRLGEWDVRGQEERLNHEEYGIE 394
            |::    ...::..|||:::...||:|||||... |...|.|:|.|. |..|....|...:..| 
Human   220 VSI----QYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGS-DKLGSFPSLAVAKIII- 278

  Fly   395 RKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMAT---VAGWGRTRHGQS 456
             .|.:|.| |.|  ||:||::|...:.:...:.|:|||....:||  .||   :.|||.|:....
Human   279 -IEFNPMY-PKD--NDIALMKLQFPLTFSGTVRPICLPFFDEELT--PATPLWIIGWGFTKQNGG 337

  Fly   457 TVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRK 521
            .:..:|.:..|:||.:.||.......|.   :.:..:|||..:||.|:|||||||||....| :.
Human   338 KMSDILLQASVQVIDSTRCNADDAYQGE---VTEKMMCAGIPEGGVDTCQGDSGGPLMYQSD-QW 398

  Fly   522 TLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKV 555
            .::|:||||.|||....|||||.:..::.||..|
Human   399 HVVGIVSWGYGCGGPSTPGVYTKVSAYLNWIYNV 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 85/240 (35%)
Tryp_SPc 316..555 CDD:238113 86/242 (36%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 19/104 (18%)
Tryp_SPc 204..429 CDD:214473 85/240 (35%)
Tryp_SPc 205..432 CDD:238113 86/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.