DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and PRSS8

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_002764.1 Gene:PRSS8 / 5652 HGNCID:9491 Length:343 Species:Homo sapiens


Alignment Length:248 Identity:89/248 - (35%)
Similarity:135/248 - (54%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   315 RIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPNSN-MKIRLG--E 376
            ||.||.|...|..||||::...|...    |||:|:|.:||::||||..|..:.. .:::||  :
Human    44 RITGGSSAVAGQWPWQVSITYEGVHV----CGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQ 104

  Fly   377 WDVRGQEERLNHEEYGIERKEV--HPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKL- 438
            .|...::.:::      ..|::  ||.|.......|:||::|.|.:.:.::|.|:|||.:.... 
Human   105 LDSYSEDAKVS------TLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFP 163

  Fly   439 TGKMATVAGWGRTRHGQSTV-PSVLQEVDVEVISNDRCQRWFRAAGRREAIHDV---FLCAGYKD 499
            .|...||.|||......|.: |..||:::|.:||.:.|...:....:.|..|.|   .:||||.:
Human   164 NGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVE 228

  Fly   500 GGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWI 552
            ||:|:|||||||||:..::|...|.|:||||..||..:.|||||....:..||
Human   229 GGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 87/246 (35%)
Tryp_SPc 316..555 CDD:238113 88/247 (36%)
PRSS8NP_002764.1 Tryp_SPc 44..281 CDD:214473 87/246 (35%)
Tryp_SPc 45..284 CDD:238113 88/247 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3380
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.