DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and prss8

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:265 Identity:81/265 - (30%)
Similarity:121/265 - (45%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 NRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS-------------- 364
            :||||||....|..|||.:|...|    ...||.||||..:::|||||..|              
 Frog    28 SRIVGGHDASEGMFPWQASLRYDG----NHVCGAALISANFIVTAAHCFPSDHSLVGYSVYLGVL 88

  Fly   365 ---TPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHI 426
               .|:||.::                  ..:::..::|.|:......|:|:..||....:...:
 Frog    89 QLGVPSSNSQL------------------LKLKQVTIYPSYSHDTSSGDLAVAALDSPATFSHVV 135

  Fly   427 IPVCLPPSTTKL-TGKMATVAGWGRTRHGQSTVPSV--LQEVDVEVISNDRCQRWFR---AAGRR 485
            .|:.||.:..:. .|....|.|||..:.|.: :|..  ||..:|::|....|...:.   :|...
 Frog   136 QPISLPAANVQFPIGMTCQVTGWGNIQQGVN-LPGAKNLQVGNVKLIGRQTCNCLYNIKPSADSM 199

  Fly   486 EAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVP 550
            .:|....:|||...|..|:||||||||||.|::|:..|..:||||..||.::.||||..|..:..
 Frog   200 GSIQPDMICAGSAAGSVDACQGDSGGPLTCTVNGKAYLAAVVSWGDECGAQNKPGVYILISAYAS 264

  Fly   551 WINKV 555
            ||..:
 Frog   265 WIQGI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 79/259 (31%)
Tryp_SPc 316..555 CDD:238113 80/261 (31%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 79/259 (31%)
Tryp_SPc 30..269 CDD:238113 80/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.