DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG9733

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:281 Identity:101/281 - (35%)
Similarity:145/281 - (51%) Gaps:47/281 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 PGCGEVYTRSNRIVGGHSTGFGSHPWQVAL-----IKSGFLTRKLSCGGALISNRWVITAAHC-- 361
            |.||.|..| |||..|..|.....||.|.|     ..:|..|   :|.|:||:.|:|:|||||  
  Fly   151 PSCGGVGIR-NRIYDGQDTDVNEFPWMVLLEYRRRSGNGLST---ACAGSLINRRYVLTAAHCLT 211

  Fly   362 --VASTPNSNMKIRLGEWDVR-------------GQEERLNHEEYGIERKEVHPHYN--PADFVN 409
              :.....:.:.:||||.|.|             .:.:||     |.|...||..|:  .::.|:
  Fly   212 GRIEREVGTLVSVRLGEHDTRTAVDCPPGGGSCSPEVQRL-----GFEEIRVHERYSEKASNQVH 271

  Fly   410 DVALIRLDRNVVYKQHIIPVCLPPST---TKLTGKMATVAGWGRT-RHGQSTVPSVLQEVDVEVI 470
            |:.|||::|||.|..:|.|:|||.|.   ::.:|:..|||||||| :..:|   :|.|:|.|..:
  Fly   272 DIGLIRMERNVRYSDNIQPICLPSSVGLESRQSGQQFTVAGWGRTLKMARS---AVKQKVTVNYV 333

  Fly   471 SNDRCQRWFRAAGRREAIHDVFLCAG--YKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGC 533
            ...:|::.|...  :..:....||||  ::   :|||.|||||||....|....|.|:||:|..|
  Fly   334 DPAKCRQRFSQI--KVNLEPTQLCAGGQFR---KDSCDGDSGGPLMRFRDESWVLEGIVSFGYKC 393

  Fly   534 GREHLPGVYTNIQRFVPWINK 554
            |.:..||||||:..:..||.:
  Fly   394 GLKDWPGVYTNVAAYDIWIRQ 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 93/266 (35%)
Tryp_SPc 316..555 CDD:238113 94/269 (35%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 93/266 (35%)
Tryp_SPc 162..415 CDD:238113 94/269 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457344
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.