DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and ea

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_524362.2 Gene:ea / 41858 FlyBaseID:FBgn0000533 Length:392 Species:Drosophila melanogaster


Alignment Length:299 Identity:112/299 - (37%)
Similarity:150/299 - (50%) Gaps:61/299 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 SYRPVPG-CGEVYTRSNRIVGGHSTGFGSHPWQVALI-------KSGFLTRKLSCGGALISNRWV 355
            |..|:|| ||.:.  ||||.||..|.....|| :|||       |.|.     .|||:|||.|:|
  Fly   112 SLLPLPGQCGNIL--SNRIYGGMKTKIDEFPW-MALIEYTKSQGKKGH-----HCGGSLISTRYV 168

  Fly   356 ITAAHCVASTPNSNMK----------IRLGEW----------DVRGQEE-RLNHEEYGIERKEVH 399
            |||:|||      |.|          :|||||          ||||.:: ...|.:..:||...|
  Fly   169 ITASHCV------NGKALPTDWRLSGVRLGEWDTNTNPDCEVDVRGMKDCAPPHLDVPVERTIPH 227

  Fly   400 PHYNPA--DFVNDVALIRLDRNVVYKQHIIPVCLPPS----TTKLTGKMATVAGWGRTRHGQSTV 458
            |.|.||  :.|||:||:||.:.|.|...:.|:|||..    :....|....|||||:|.  |.:.
  Fly   228 PDYIPASKNQVNDIALLRLAQQVEYTDFVRPICLPLDVNLRSATFDGITMDVAGWGKTE--QLSA 290

  Fly   459 PSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKT- 522
            .::..:..||....|.||..:  :.:...:.|..:|||.|: |.|||:||||||| :.:|..|. 
  Fly   291 SNLKLKAAVEGFRMDECQNVY--SSQDILLEDTQMCAGGKE-GVDSCRGDSGGPL-IGLDTNKVN 351

  Fly   523 ----LIGLVSWG-IGCGREHLPGVYTNIQRFVPWINKVM 556
                |.|:||:| ..||....|||||.:.::|.||...:
  Fly   352 TYYFLAGVVSFGPTPCGLAGWPGVYTLVGKYVDWIQNTI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 102/276 (37%)
Tryp_SPc 316..555 CDD:238113 103/278 (37%)
eaNP_524362.2 CLIP 37..89 CDD:288855
Tryp_SPc 127..386 CDD:214473 102/276 (37%)
Tryp_SPc 128..389 CDD:238113 103/278 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
32.840

Return to query results.
Submit another query.