DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and tpr

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:413 Identity:118/413 - (28%)
Similarity:175/413 - (42%) Gaps:88/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 LSAAPSTSSTASSSARPAYPSSYYGTKRPTHYS---GSNPYKPGSSAGGSSRPSSSSSSSLNSWE 223
            ||..||.|::...:......|......:.|...   ...|.:||||...::..::.||||:..  
  Fly    14 LSCGPSQSASQDRATNQTAASPLLKQSQNTFIQWVLSLLPQRPGSSDSENATLATLSSSSMMP-- 76

  Fly   224 HETGGHLGSISGITNHLDSFFDAESQAPLDSAG----------APPPHEPLPNAQAFAVGNVLDL 278
                             |:.....:..|..|:.          |||...|..|.....       
  Fly    77 -----------------DAASTTSTTTPAPSSSTTTTRRATTPAPPTLNPPRNCSDCV------- 117

  Fly   279 NAGEAADEYQSGGSGGYHDASYRPVPGCGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKL 343
                                       || :.....|||||..|....:||...|:..|    :.
  Fly   118 ---------------------------CG-IANIQKRIVGGQETEVHQYPWVAMLLYGG----RF 150

  Fly   344 SCGGALISNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERK--EV--HPHYNP 404
            .|..:|:::::::||:|||.......:.:||.|.|     .:::|.: .|:||  ||  ||.||.
  Fly   151 YCAASLLNDQFLLTASHCVYGFRKERISVRLLEHD-----RKMSHMQ-KIDRKVAEVITHPKYNA 209

  Fly   405 ADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEV 469
            .::.||:|:|:||..|.:.:.:.|||:|.......|:...|.|||..:.|..| ...||||.|.:
  Fly   210 RNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPI 273

  Fly   470 ISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRK--TLIGLVSWGIG 532
            :|.|.|    |.:.....|.|..||.||.:||:|||||||||||.:...|.:  .:.|:||||.|
  Fly   274 LSQDEC----RKSRYGNKITDNMLCGGYDEGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEG 334

  Fly   533 CGREHLPGVYTNIQRFVPWINKV 555
            |.:...||||..:.|:..||..:
  Fly   335 CAKAGYPGVYARVNRYGTWIKNL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/242 (37%)
Tryp_SPc 316..555 CDD:238113 91/244 (37%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 90/242 (37%)
Tryp_SPc 127..356 CDD:238113 91/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457747
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
43.740

Return to query results.
Submit another query.