DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and PRSS41

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:314 Identity:105/314 - (33%)
Similarity:151/314 - (48%) Gaps:49/314 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GNVLDLNAGEAADEYQSGGSGGYH-----DASYRPV--PGCG--EVYTRSNRIVGGHSTGFGSHP 328
            |.:..|.||..|.....||....|     ::....:  ..||  |::.   .:.||..:..|..|
Human    22 GELGALQAGPGAARRPGGGGREGHFLCPAESQEEELLSEACGHREIHA---LVAGGVESARGRWP 83

  Fly   329 WQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS--TPNSNMKIRLGE-------WDVRGQEE 384
            ||.:|    .|.|:..|||:|:|.|||::||||...  .| |...::|||       |::|....
Human    84 WQASL----RLRRRHRCGGSLLSRRWVLSAAHCFQKHYYP-SEWTVQLGELTSRPTPWNLRAYSS 143

  Fly   385 R-------LNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPVCLPPSTTKLTGKM 442
            |       :|.:..|:.|             ||:||:||..:|.|..:|.|:|:..||.....:.
Human   144 RYKVQDIIVNPDALGVLR-------------NDIALLRLASSVTYNAYIQPICIESSTFNFVHRP 195

  Fly   443 -ATVAGWGRTRHGQSTVPSV--LQEVDVEVISNDRCQRWFRAAGRREAIHDVFLCAGYKDGGRDS 504
             ..|.|||......:.:|..  |:|..|.:::|.||...|.....|..|.|...|||.:||..|:
Human   196 DCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFEQPSSRSMIWDSMFCAGAEDGSVDT 260

  Fly   505 CQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVMAN 558
            |:|||||||....||....:|:||||:.||:.:.|||||||..:..||.:||::
Human   261 CKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFHWIRRVMSH 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 90/255 (35%)
Tryp_SPc 316..555 CDD:238113 92/257 (36%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 159 1.000 Inparanoid score I4261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.970

Return to query results.
Submit another query.