DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG8170

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster


Alignment Length:454 Identity:147/454 - (32%)
Similarity:196/454 - (43%) Gaps:101/454 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 PSSYYGTKRPTHYSGSNPYKPGSS------------AGGSSRPSSSSSSSLN--------SWEHE 225
            ||.|.||::..:|    |||...|            ..|.|.|:.||..|.|        ::..:
  Fly   419 PSEYQGTRKSRYY----PYKSSRSPRVVFPTNDNVGTTGPSGPAGSSGPSGNGVYFSDNIAFRDQ 479

  Fly   226 TGG--HLGSISGITN-----HLDSFFDAES----------------------------------- 248
            ..|  .|.::..:.|     .|||..:|.|                                   
  Fly   480 NFGINELAAVQDVRNDYSLQDLDSASEATSSPQSASTFKEKVDITTDTECQHRGGTCEFFLGCWL 544

  Fly   249 -----QAPLDSAGAPPPHEPLPNAQAFA---VGNVLDLNAGEAADEYQSGGSGGYHDASYRPV-- 303
                 |...|.......|....:|...:   |||.:||     .|..|.         :|.||  
  Fly   545 SGGLIQGTCDGLLRGCCHRTAKSANLGSSDFVGNAVDL-----TDLPQK---------NYGPVNN 595

  Fly   304 -PGCG---EVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVAS 364
             |.||   ...|...|||||...||||.||| |.|:.|    ...|||:|||.|.|:||.||||.
  Fly   596 EPSCGISLAKQTAQRRIVGGDDAGFGSFPWQ-AYIRIG----SSRCGGSLISRRHVVTAGHCVAR 655

  Fly   365 TPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPH--YNPADFVNDVALIRLDRNVVYKQHII 427
            .....:.:.||::.:....|.|....:|:.|.:|||:  :.|.....|::::.|:|.|.:..||.
  Fly   656 ATPRQVHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIA 720

  Fly   428 PVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFRAAGRREAIHDVF 492
            |:|||.......||....||||....|....|..||.|||.||.|..|:||.|..|....|:...
  Fly   721 PICLPEKNEDFLGKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEM 785

  Fly   493 LCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFVPWINKVM 556
            |||||::||:|||||||||||....:||..|||:||.|..|.....||:|.::.:.|.|::.|:
  Fly   786 LCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 102/238 (43%)
Tryp_SPc 316..555 CDD:238113 102/240 (43%)
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 102/238 (43%)
Tryp_SPc 612..846 CDD:238113 102/238 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3858
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.