DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and Prss33

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:XP_017173005.1 Gene:Prss33 / 353130 MGIID:2661234 Length:341 Species:Mus musculus


Alignment Length:263 Identity:99/263 - (37%)
Similarity:130/263 - (49%) Gaps:32/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 CGEVYTRSNRIVGGHSTGFGSHPWQVALIKSGFLTRKLSCGGALISNRWVITAAHCVASTPN--- 367
            ||:. ..|:|||||.....|..|||.::...|...    |||:||:.:||:||.||.   |.   
Mouse    89 CGQP-RMSSRIVGGRDAQDGEWPWQTSIQHRGAHV----CGGSLIAPQWVLTAGHCF---PRRVW 145

  Fly   368 -SNMKIRLG--EWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIRLDRNVVYKQHIIPV 429
             |...:.||  ..|||...|.|    ..:.|..:.|.|:..:...|:||::|...|.....|.||
Mouse   146 PSEYSVLLGALSLDVRSSHELL----VPVLRVLLPPDYSEDEARGDLALLQLRHPVSLSTRIQPV 206

  Fly   430 CLP-PSTTKLTGKMATVAGWGRTRHGQSTVP----SVLQEVDVEVISNDRCQRWFRAA-----GR 484
            ||| |.:....|....|.|||....|   ||    ..||.|.|.::.:..|.|.:...     |.
Mouse   207 CLPAPGSHPPPGSPCWVTGWGSLSPG---VPLPKGRPLQGVRVPLLDSRACDRLYHVGANVPQGE 268

  Fly   485 REAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMDGRKTLIGLVSWGIGCGREHLPGVYTNIQRFV 549
            |..:.. .|||||:.|.:|:||||||||||....|...|:|:||||.||...:.||||||:.::.
Mouse   269 RIVLPG-NLCAGYRRGHKDACQGDSGGPLTCMESGHWVLVGVVSWGKGCALPNRPGVYTNVAKYS 332

  Fly   550 PWI 552
            |||
Mouse   333 PWI 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 94/252 (37%)
Tryp_SPc 316..555 CDD:238113 95/253 (38%)
Prss33XP_017173005.1 Tryp_SPc 98..336 CDD:238113 95/253 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3858
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D426785at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.