DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8172 and CG4793

DIOPT Version :9

Sequence 1:NP_001097235.2 Gene:CG8172 / 35905 FlyBaseID:FBgn0033362 Length:561 Species:Drosophila melanogaster
Sequence 2:NP_723941.2 Gene:CG4793 / 34941 FlyBaseID:FBgn0028514 Length:910 Species:Drosophila melanogaster


Alignment Length:272 Identity:80/272 - (29%)
Similarity:131/272 - (48%) Gaps:28/272 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 ASYRPVP-GCGEVYTRSNRIVGGHSTGF-----------GSHPWQVALIKSGFLTRKLSCGGALI 350
            |..:|:| .||.|    |||    ..||           |..||.|||:.|  .:|....||:||
  Fly    77 ADNQPLPTECGHV----NRI----GVGFTITNARDIAQKGELPWMVALLDS--RSRLPLGGGSLI 131

  Fly   351 SNRWVITAAHCVASTPNSNMKIRLGEWDVRGQEERLNHEEYGIERKEVHPHYNPADFVNDVALIR 415
            :...|:|::......|...:.:|.||||.....|...||:..|.:...|.:.:..:..|:.||:.
  Fly   132 TRDVVLTSSTKTLEVPEKYLIVRAGEWDFESITEERAHEDVAIRKIVRHTNLSVENGANNAALLF 196

  Fly   416 LDRNVVYKQHIIPVCLPPSTTKLTGKMATVAGWGRTRHGQSTVPSVLQEVDVEVISNDRCQRWFR 480
            |.|.:....||..:||||...........|:|||:.....::..::|:::::.::....||...:
  Fly   197 LARPLKLDHHIGLICLPPPNRNFIHNRCIVSGWGKKTALDNSYMNILKKIELPLVDRSVCQTKLQ 261

  Fly   481 AA-GRREAIHDVFLCAGYKDGGRDSCQGDSGGPLTLTMD---GRKTLIGLVSWGIGCGREHLPGV 541
            .. |:...:.:..:||| .:.|:|:|:||.|.||...:.   .|..|:|:|::|.|||.. ||..
  Fly   262 GPYGKDFILDNSLICAG-GEPGKDTCKGDGGAPLACPLQSDPNRYELLGIVNFGFGCGGP-LPAA 324

  Fly   542 YTNIQRFVPWIN 553
            ||::.:...||:
  Fly   325 YTDVSQIRSWID 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8172NP_001097235.2 Tryp_SPc 315..552 CDD:214473 71/251 (28%)
Tryp_SPc 316..555 CDD:238113 72/253 (28%)
CG4793NP_723941.2 Tryp_SPc 105..337 CDD:238113 69/236 (29%)
Tryp_SPc 105..335 CDD:214473 67/233 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.